PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G26960.1
Common NameAtHB23, ATHB-23, HB23, T2P11.15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 255aa    MW: 29662.9 Da    PI: 4.8016
Description homeobox protein 23
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G26960.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.22.5e-1771124356
                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  k+++++ eql++Le+ Fe  +++  +++ eLA+ lgL+ rq+ +WFqNrRa+ k
  AT1G26960.1  71 KKRRLNMEQLKALEKDFELGNKLESDRKLELARALGLQPRQIAIWFQNRRARSK 124
                  456899**********************************************99 PP

2HD-ZIP_I/II121.34.8e-3970162193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl+ eq+k+LE+ Fe  +kLe++rK elar+Lglqprq+a+WFqnrRAR ktkqlEkdy++Lkr++++l++ene L++++++L++++++
  AT1G26960.1  70 EKKRRLNMEQLKALEKDFELGNKLESDRKLELARALGLQPRQIAIWFQNRRARSKTKQLEKDYDMLKRQFESLRDENEVLQTQNQKLQAQVMA 162
                  69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.41E-1852128IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-1859126IPR009057Homeodomain-like
PROSITE profilePS5007117.10366126IPR001356Homeobox domain
SMARTSM003892.2E-1769130IPR001356Homeobox domain
CDDcd000866.54E-1471127No hitNo description
PfamPF000461.1E-1471124IPR001356Homeobox domain
PRINTSPR000314.5E-697106IPR000047Helix-turn-helix motif
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PRINTSPR000314.5E-6106122IPR000047Helix-turn-helix motif
PfamPF021831.4E-14126166IPR003106Leucine zipper, homeobox-associated
SMARTSM003400.0053126169IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0004726anatomyvascular leaf primordium adaxial side
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0020148anatomyshoot apical meristem
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001052developmental stagevascular leaf expansion stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MSCNNNGLAF FPENFSLQNH HQEEEDHPQL LQDFHGFLGK RSPMNNVQGF CNLDMNGDEE  60
YSDDGSKMGE KKRRLNMEQL KALEKDFELG NKLESDRKLE LARALGLQPR QIAIWFQNRR  120
ARSKTKQLEK DYDMLKRQFE SLRDENEVLQ TQNQKLQAQV MALKSREPIE SINLNKETEG  180
SCSDRSENIS GDIRPPEIDS QFALGHPPTT TTMQFFQNSS SEQRMVKEEN SISNMFCGID  240
DQSGFWPWLD QQQYN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118126RRARSKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.435610.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453361470.0
Genevisible263690_at0.0
Expression AtlasAT1G26960-
AtGenExpressAT1G26960-
ATTED-IIAT1G26960-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young leaves, in the adaxial domain of leaf primordia and the rib meristem. Expressed in the styles of flowers and siliques. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:17387478}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain leucine zipper class I (HD-Zip I) protein.
UniProtProbable transcription factor. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. results indicate that ATHB23 is under the control of GA and other activators such as PHB, and is involved in establishing polarity during leaf development
    [PMID: 17387478]
  2. ATHB23 transcription factor is a novel component of the phyB-mediated red light signaling pathway.
    [PMID: 23964902]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G26960.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By gibberellic acid (GA3). {ECO:0000269|PubMed:17387478}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G26960, AT1G69600, AT1G75240
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G26960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2280560.0AK228056.1 Arabidopsis thaliana mRNA for putative DNA-binding protein, complete cds, clone: RAFL14-55-J15.
GenBankAY0849130.0AY084913.1 Arabidopsis thaliana clone 121220 mRNA, complete sequence.
GenBankBT0097270.0BT009727.1 Arabidopsis thaliana At1g26960 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564268.10.0homeobox-leucine zipper protein ATHB-23
SwissprotQ8LFD30.0ATB23_ARATH; Homeobox-leucine zipper protein ATHB-23
TrEMBLD7KPM40.0D7KPM4_ARALL; ATHB23
STRINGAT1G26960.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26332770
Representative plantOGRP12916189
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  4. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  5. Tan QK,Irish VF
    The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development.
    Plant Physiol., 2006. 140(3): p. 1095-108
    [PMID:16428600]
  6. Kim YK, et al.
    ATHB23, an Arabidopsis class I homeodomain-leucine zipper gene, is expressed in the adaxial region of young leaves.
    Plant Cell Rep., 2007. 26(8): p. 1179-85
    [PMID:17387478]
  7. Choi H, et al.
    The homeodomain-leucine zipper ATHB23, a phytochrome B-interacting protein, is important for phytochrome B-mediated red light signaling.
    Physiol Plant, 2014. 150(2): p. 308-20
    [PMID:23964902]